PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA19611
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 278aa    MW: 28879.8 Da    PI: 10.0925
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA19611genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.13.3e-372281362
                     zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                               +  ++cprC+s ntkfCy+nnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rk k+++
  Tp57577_TGAC_v2_mRNA19611 22 QPPQECPRCQSFNTKFCYFNNYSLNQPRYFCKSCRRYWTQGGTLRNVPVGGGSRKGKRAK 81
                               66789**************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-241079IPR003851Zinc finger, Dof-type
PfamPF027012.2E-322479IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.3322579IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102763IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MEQGGDGGKR GEMNRQLHPH PQPPQECPRC QSFNTKFCYF NNYSLNQPRY FCKSCRRYWT  60
QGGTLRNVPV GGGSRKGKRA KNSPSTSTSN SSGNSSVSQP MLPQPTVQST MAAMAKDSAL  120
SLTSFSSAAP FYQGGGGVGY MSSFAAFNQS LNPNLSAHNF DHPSLNLGGV GSSNLSLLQG  180
FNVAAALGNS SQGPNRPSMQ QYYQMAGNGG MFTSQQQGLN LIPSSTTSNA SVAAASNIWP  240
QSFMNGTLGT TSIPSGNSDR NGSGAGGSGS SVAGAGSP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003593604.14e-76Dof domain zinc finger protein
TrEMBLG7ISC24e-76G7ISC2_MEDTR; Dof domain zinc finger protein
STRINGGLYMA13G31110.12e-49(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41453258
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.14e-31TARGET OF MONOPTEROS 6